Lineage for d4n7ia_ (4n7i A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781960Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries)
  8. 1781965Domain d4n7ia_: 4n7i A: [257132]
    automated match to d2fbed_
    complexed with bme, cl, gol, mg

Details for d4n7ia_

PDB Entry: 4n7i (more details), 1.4 Å

PDB Description: Crystal Structure of Intracellular B30.2 Domain of BTN3A1
PDB Compounds: (A:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d4n7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n7ia_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gaynewkkalfkpadvildpktadpillvsedqrsverakepqdlpdnperfnwhycvlg
cesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlte
prtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlept
alticpa

SCOPe Domain Coordinates for d4n7ia_:

Click to download the PDB-style file with coordinates for d4n7ia_.
(The format of our PDB-style files is described here.)

Timeline for d4n7ia_: