Class b: All beta proteins [48724] (176 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.1: WW domain [51045] (2 families) |
Family b.72.1.0: automated matches [227264] (1 protein) not a true family |
Protein automated matches [227055] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226058] (13 PDB entries) |
Domain d4n7fb_: 4n7f B: [235899] automated match to d2jmfa1 |
PDB Entry: 4n7f (more details), 1.1 Å
SCOPe Domain Sequences for d4n7fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n7fb_ b.72.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} amgsflpkgwevrhapngrpffidhntktttwedprl
Timeline for d4n7fb_: