Lineage for d4n70a_ (4n70 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589317Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
    OPK group(?); PIM subfamily; serine/threonine kinase
  7. 2589318Species Human (Homo sapiens) [TaxId:9606] [118134] (110 PDB entries)
    Uniprot P11309 33-305 ! Uniprot P11309 32-308
  8. 2589353Domain d4n70a_: 4n70 A: [253916]
    automated match to d4k18a_
    complexed with 2hx

Details for d4n70a_

PDB Entry: 4n70 (more details), 2.1 Å

PDB Description: Pim1 Complexed with a pyridylcarboxamide
PDB Compounds: (A:) Serine/threonine-protein kinase pim-1

SCOPe Domain Sequences for d4n70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n70a_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
eplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevv
llkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqv
leavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppe
wiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcl
alrpsdrptfeeiqnhpwmqdvllpqetaeihlhs

SCOPe Domain Coordinates for d4n70a_:

Click to download the PDB-style file with coordinates for d4n70a_.
(The format of our PDB-style files is described here.)

Timeline for d4n70a_: