Lineage for d4n6da_ (4n6d A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880486Species Desulfovibrio salexigens [TaxId:526222] [256368] (3 PDB entries)
  8. 1880489Domain d4n6da_: 4n6d A: [266880]
    automated match to d4p47a_
    complexed with cl, edo, i3c

Details for d4n6da_

PDB Entry: 4n6d (more details), 1.7 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site
PDB Compounds: (A:) TRAP dicarboxylate transporter-DctP subunit

SCOPe Domain Sequences for d4n6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n6da_ c.94.1.0 (A:) automated matches {Desulfovibrio salexigens [TaxId: 526222]}
adislsyanfppaktfpcvqmerwkqevekrtagkvqvqtypgstllgakntlrgvmqgq
adigcvslayhpgvfplssvfelplgftsstsaslalwdlytkyqpkefkrfkvltmfas
apsnimtkvpvrnlddlkglevrasgilskileslgatpvsmpmsatpealqkgvvkglf
ssfevlkdlnfaeicryetetntavypfaiimnmnswnslpddvkkvlndlgreqaewtg
kymdehvkrslawakdkysiemikmsdadmqaikdktlpliedwkekaaakgvdgaavls
dveelrikyegkaenlyfq

SCOPe Domain Coordinates for d4n6da_:

Click to download the PDB-style file with coordinates for d4n6da_.
(The format of our PDB-style files is described here.)

Timeline for d4n6da_: