Lineage for d4n5zb_ (4n5z B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969886Domain d4n5zb_: 4n5z B: [229158]
    Other proteins in same PDB: d4n5za_, d4n5zc_, d4n5ze_, d4n5zg_, d4n5zi_, d4n5zk_, d4n5zm_, d4n5zo_, d4n5zq_, d4n5zs_, d4n5zu_, d4n5zw_, d4n5zy_
    automated match to d2fk0b1
    complexed with nag; mutant

Details for d4n5zb_

PDB Entry: 4n5z (more details), 2.95 Å

PDB Description: crystal structure of aerosol transmissible influenza h5 hemagglutinin mutant (n158d, n224k, q226l and t318i) from the influenza virus a/viet nam/1203/2004 (h5n1)
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4n5zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5zb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr

SCOPe Domain Coordinates for d4n5zb_:

Click to download the PDB-style file with coordinates for d4n5zb_.
(The format of our PDB-style files is described here.)

Timeline for d4n5zb_: