Lineage for d4n5db_ (4n5d B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.17: Caspase-like [52128] (1 superfamily)
3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the restSuperfamily c.17.1: Caspase-like [52129] (3 families) 
mature protein may be composed of two chains folded in a single domain
Family c.17.1.0: automated matches [191651] (1 protein)
not a true familyProtein automated matches [191201] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [189525] (14 PDB entries) 
Domain d4n5db_: 4n5d B: [229925]
automated match to d3s8eg_
complexed with 2fq, mpd, po4
Details for d4n5db_
PDB Entry: 4n5d (more details), 2.06 Å
PDB Description: Tailoring Small Molecules for an Allosteric Site on Procaspase-6: Cpd1
PDB Compounds: (B:) Caspase-6SCOPe Domain Sequences for d4n5db_:
Sequence, based on SEQRES records: (download)
>d4n5db_ c.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfn
dlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkch
slvgkpkifiiqaargnqhdvpvipldvvdnqtekldtnitevdaasvytlpagadflmc
ysvaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkvsqrrvdfckdpsa
igkkqvpcfasmltkklhffpk
Sequence, based on observed residues (ATOM records): (download)
>d4n5db_ c.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfn
dlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkch
slvgkpkifiiqaargnqtnitevdaasvytlpagadflmcysvaegyyshretvngswy
iqdlcemlgkygssleftelltlvnrkvsqrrvdfckdpsaigkkqvpcfasmltkklhf
fpk
SCOPe Domain Coordinates for d4n5db_:
Click to download the PDB-style file with coordinates for d4n5db_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4n5db_:
- d4n5db_ first appeared in SCOPe 2.03
- d4n5db_ appears in SCOPe 2.04
- d4n5db_ appears in SCOPe 2.06
- d4n5db_ appears in the current release, SCOPe 2.08
View in 3D
