Lineage for d4mzza_ (4mzz A:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.32: GLA-domain [57629] (1 superfamily)
Calcium ion-boundSuperfamily g.32.1: GLA-domain [57630] (2 families) 
gamma-carboxy-glutamic acid-rich domainFamily g.32.1.1: GLA-domain [57631] (7 proteins)
heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures
Protein automated matches [229333] (1 species)
not a true proteinSpecies Cow (Bos taurus) [TaxId:9913] [229334] (1 PDB entry) 
Domain d4mzza_: 4mzz A: [229335]
automated match to d1q3ma_
Details for d4mzza_
PDB Entry: 4mzz (more details), 1.88 Å
PDB Description: Crystal structure of Bovine 3 Glu-Osteocalcin.
PDB Compounds: (A:) OsteocalcinSCOPe Domain Sequences for d4mzza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mzza_ g.32.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
epkrevcelnpdcdeladhigfqeayrrfyg
SCOPe Domain Coordinates for d4mzza_:
Click to download the PDB-style file with coordinates for d4mzza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mzza_:
- d4mzza_ first appeared in SCOPe 2.03
- d4mzza_ appears in SCOPe 2.07
View in 3D
