Lineage for d4mx6a_ (4mx6 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523498Species Shewanella oneidensis [TaxId:211586] [267968] (1 PDB entry)
  8. 2523499Domain d4mx6a_: 4mx6 A: [266839]
    automated match to d4p47a_
    complexed with cl, sin

Details for d4mx6a_

PDB Entry: 4mx6 (more details), 1.1 Å

PDB Description: Crystal structure of a trap periplasmic solute binding protein from shewanella oneidensis (SO_3134), target EFI-510275, with bound succinate
PDB Compounds: (A:) TRAP-type C4-dicarboxylate:H+ symport system substrate-binding component DctP

SCOPe Domain Sequences for d4mx6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mx6a_ c.94.1.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
apveikfshvvaentpkgqmalkfkelveqrlpgeytvsvfpnsqlfgdnnelaalllnd
vqfvapslskferytkrlqvfdlpflfndmdavnrfqqgeagqallnsmsrkgivglgyl
hngmkqftantplkqpsdakglkfrvmasdvlaaqfdavgaipvkkpfsevftllqtrai
dgqentwsntysqkfyevqshitesnhgvldymvvtsdafwkslpadkrkvikealdesi
algnkiaaekdnedkqlildsklsqlvtlspaerqqwvdvmkpvwskfedqvgkdvieaa
vaank

SCOPe Domain Coordinates for d4mx6a_:

Click to download the PDB-style file with coordinates for d4mx6a_.
(The format of our PDB-style files is described here.)

Timeline for d4mx6a_: