Lineage for d4mwfb1 (4mwf B:3-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743021Domain d4mwfb1: 4mwf B:3-107 [229713]
    Other proteins in same PDB: d4mwfa_, d4mwfb2, d4mwfh_, d4mwfl2
    automated match to d1g9ml1
    complexed with nag

Details for d4mwfb1

PDB Entry: 4mwf (more details), 2.65 Å

PDB Description: structure of hepatitis c virus envelope glycoprotein e2 core bound to broadly neutralizing antibody ar3c
PDB Compounds: (B:) Fab AR3C light chain

SCOPe Domain Sequences for d4mwfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mwfb1 b.1.1.1 (B:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygastratgiparf
sgsgsgteftltvsrlepedsavyfcqqyyrspltfgggtkveik

SCOPe Domain Coordinates for d4mwfb1:

Click to download the PDB-style file with coordinates for d4mwfb1.
(The format of our PDB-style files is described here.)

Timeline for d4mwfb1:

2743021
d4mwfb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4mwfb2