Lineage for d4mmzc_ (4mmz C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2036221Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2036222Protein automated matches [190976] (4 species)
    not a true protein
  7. 2036246Species Human (Homo sapiens) [TaxId:9606] [188649] (54 PDB entries)
  8. 2036320Domain d4mmzc_: 4mmz C: [266751]
    Other proteins in same PDB: d4mmza1, d4mmza2, d4mmza3, d4mmza4
    automated match to d2ocfd_
    complexed with cl, gol, mn, na, nag

Details for d4mmzc_

PDB Entry: 4mmz (more details), 3.1 Å

PDB Description: integrin alphavbeta3 ectodomain bound to an antagonistic tenth domain of fibronectin
PDB Compounds: (C:) Fibronectin

SCOPe Domain Sequences for d4mmzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mmzc_ b.1.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdvprdlevvaatptslliswdapavtvryyritygetggnspvqeftvpgskstatisg
lkpgvdytitvyavtprgdwnegskpisiny

SCOPe Domain Coordinates for d4mmzc_:

Click to download the PDB-style file with coordinates for d4mmzc_.
(The format of our PDB-style files is described here.)

Timeline for d4mmzc_: