Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families) automatically mapped to Pfam PF03900 |
Family d.50.2.0: automated matches [227289] (1 protein) not a true family |
Protein automated matches [227108] (3 species) not a true protein |
Species Bacillus megaterium [TaxId:1404] [238215] (5 PDB entries) |
Domain d4mlqa2: 4mlq A:219-308 [238216] Other proteins in same PDB: d4mlqa1, d4mlqa3 automated match to d1gtka2 complexed with 29p, acy, dpm |
PDB Entry: 4mlq (more details), 1.6 Å
SCOPe Domain Sequences for d4mlqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mlqa2 d.50.2.0 (A:219-308) automated matches {Bacillus megaterium [TaxId: 1404]} nhdetaravraervflkemeggcqvpiagygrildggnieltslvaspdgktiykehitg kdpiaigseaaerltsqgakllidrvkeel
Timeline for d4mlqa2: