Lineage for d4mija_ (4mij A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879919Protein TRAP dicarboxylate transporter [267666] (2 species)
  7. 1879920Species Polaromonas [TaxId:296591] [267752] (1 PDB entry)
  8. 1879921Domain d4mija_: 4mij A: [266737]
    complexed with ada, cl, edo, gtr

Details for d4mija_

PDB Entry: 4mij (more details), 1.1 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from polaromonas sp. js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4mija_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mija_ c.94.1.1 (A:) TRAP dicarboxylate transporter {Polaromonas [TaxId: 296591]}
tefrsadthnaddyptvaavkymgellekksggkhkikvfnkqalgseketidqvkigal
dftrvnvgpmnaicpltqvptmpflfssiahmrksldgpvgdeilkscesagfiglafyd
sgarsiyakkpirtvadakglkirvqqsdlwvalvsamganatpmpygevytglktglid
aaennipsfdtakhveavkvysktehsmapeilvmskiiydklpkaeqdmiraaakesva
ferqkwdeqeakslanvkaagaeivevdkksfqavmgpvydkfmttpdmkrlvkavqdtk
ae

SCOPe Domain Coordinates for d4mija_:

Click to download the PDB-style file with coordinates for d4mija_.
(The format of our PDB-style files is described here.)

Timeline for d4mija_: