Lineage for d4mf7a2 (4mf7 A:104-233)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713864Species Bradyrhizobium sp. [TaxId:288000] [227813] (2 PDB entries)
  8. 2713865Domain d4mf7a2: 4mf7 A:104-233 [227814]
    Other proteins in same PDB: d4mf7a1
    automated match to d4ikha2

Details for d4mf7a2

PDB Entry: 4mf7 (more details), 1.8 Å

PDB Description: Crystal structure of glutathione transferase BBTA-3750 from Bradyrhizobium sp., Target EFI-507290
PDB Compounds: (A:) Glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4mf7a2:

Sequence, based on SEQRES records: (download)

>d4mf7a2 a.45.1.0 (A:104-233) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
flpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgv
learldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerglarpa
vqrgleipkr

Sequence, based on observed residues (ATOM records): (download)

>d4mf7a2 a.45.1.0 (A:104-233) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
flpadparrwqtlqwlhfqrplqryvaeskrllgvlearldgrqwimdadytiadiatlg
wvrnligfygarelvafdelthvpawlerglarpavqrgleipkr

SCOPe Domain Coordinates for d4mf7a2:

Click to download the PDB-style file with coordinates for d4mf7a2.
(The format of our PDB-style files is described here.)

Timeline for d4mf7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mf7a1