Lineage for d4mf7a1 (4mf7 A:4-103)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879289Species Bradyrhizobium sp. [TaxId:288000] [227810] (2 PDB entries)
  8. 2879290Domain d4mf7a1: 4mf7 A:4-103 [227812]
    Other proteins in same PDB: d4mf7a2
    automated match to d4ikha1

Details for d4mf7a1

PDB Entry: 4mf7 (more details), 1.8 Å

PDB Description: Crystal structure of glutathione transferase BBTA-3750 from Bradyrhizobium sp., Target EFI-507290
PDB Compounds: (A:) Glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4mf7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mf7a1 c.47.1.0 (A:4-103) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
lssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpefl
slnpngkipaiidpngpgdkplglfesgailqylaektgq

SCOPe Domain Coordinates for d4mf7a1:

Click to download the PDB-style file with coordinates for d4mf7a1.
(The format of our PDB-style files is described here.)

Timeline for d4mf7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mf7a2