| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Bradyrhizobium sp. [TaxId:288000] [227810] (2 PDB entries) |
| Domain d4mf7a1: 4mf7 A:4-103 [227812] Other proteins in same PDB: d4mf7a2 automated match to d4ikha1 |
PDB Entry: 4mf7 (more details), 1.8 Å
SCOPe Domain Sequences for d4mf7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mf7a1 c.47.1.0 (A:4-103) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
lssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpefl
slnpngkipaiidpngpgdkplglfesgailqylaektgq
Timeline for d4mf7a1: