Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Burkholderia graminis [TaxId:396598] [227806] (2 PDB entries) |
Domain d4mf6a1: 4mf6 A:1-103 [227807] Other proteins in same PDB: d4mf6a2, d4mf6a3 automated match to d4ikha1 complexed with bez, gsh |
PDB Entry: 4mf6 (more details), 1.2 Å
SCOPe Domain Sequences for d4mf6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mf6a1 c.47.1.0 (A:1-103) automated matches {Burkholderia graminis [TaxId: 396598]} mtdlsafpitkkwpaahperlqlyslptpngvkvsimleetglpyephlvrfdtndqltp efmslnpnnkipaiidpngpdgkplplfesgailiyladktgq
Timeline for d4mf6a1: