Lineage for d4mf6a1 (4mf6 A:1-103)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134161Species Burkholderia graminis [TaxId:396598] [227806] (2 PDB entries)
  8. 2134163Domain d4mf6a1: 4mf6 A:1-103 [227807]
    Other proteins in same PDB: d4mf6a2, d4mf6a3
    automated match to d4ikha1
    complexed with bez, gsh

Details for d4mf6a1

PDB Entry: 4mf6 (more details), 1.2 Å

PDB Description: Crystal structure of glutathione transferase BgramDRAFT_1843 from Burkholderia graminis, Target EFI-507289, with two glutathione molecules bound per one protein subunit
PDB Compounds: (A:) Glutathione S-transferase domain

SCOPe Domain Sequences for d4mf6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mf6a1 c.47.1.0 (A:1-103) automated matches {Burkholderia graminis [TaxId: 396598]}
mtdlsafpitkkwpaahperlqlyslptpngvkvsimleetglpyephlvrfdtndqltp
efmslnpnnkipaiidpngpdgkplplfesgailiyladktgq

SCOPe Domain Coordinates for d4mf6a1:

Click to download the PDB-style file with coordinates for d4mf6a1.
(The format of our PDB-style files is described here.)

Timeline for d4mf6a1: