Lineage for d4mf3a_ (4mf3 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.0: automated matches [191309] (1 protein)
not a true familyProtein automated matches [190039] (161 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries) 
Domain d4mf3a_: 4mf3 A: [257079]
automated match to d3fvka_
complexed with sxi
Details for d4mf3a_
PDB Entry: 4mf3 (more details), 3 Å
PDB Description: crystal structure of human grik1 complexed with a 6-(tetrazolyl)aryl decahydroisoquinoline antagonist
PDB Compounds: (A:) Glutamate receptor ionotropic, kainate 1SCOPe Domain Sequences for d4mf3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mf3a_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slanrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgfiydvklvpdg
kygaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtp
idsaddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqtalvrnsdegiqr
vlttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqe
egklhmmkekwwrgngcp
SCOPe Domain Coordinates for d4mf3a_:
Click to download the PDB-style file with coordinates for d4mf3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mf3a_:
- d4mf3a_ first appeared in SCOPe 2.04
- d4mf3a_ appears in SCOPe 2.07
View in 3D
