Lineage for d4meza_ (4mez A:)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
Protein beta-Lactamase, class A [56606] (16 species) Species Escherichia coli, TEM-1 [TaxId:562] [56607] (63 PDB entries) 
Domain d4meza_: 4mez A: [260322]
automated match to d1li9a_
complexed with cl, gol, so4; mutant
Details for d4meza_
PDB Entry: 4mez (more details), 2.05 Å
PDB Description: crystal structure of m68l/m69t double mutant tem-1
PDB Compounds: (A:) Beta-lactamase TEMSCOPe Domain Sequences for d4meza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4meza_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpltstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw
SCOPe Domain Coordinates for d4meza_:
Click to download the PDB-style file with coordinates for d4meza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4meza_:
- d4meza_ first appeared in SCOPe 2.04
- d4meza_ appears in SCOPe 2.07
View in 3D
