Lineage for d4mcxc_ (4mcx C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322599Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2322600Protein Antitoxin HigA [158465] (2 species)
    Uncharacterized transcriptional regulator YddM
  7. 2322604Species Proteus vulgaris [TaxId:585] [229675] (3 PDB entries)
  8. 2322606Domain d4mcxc_: 4mcx C: [235601]
    automated match to d4mcxe_

Details for d4mcxc_

PDB Entry: 4mcx (more details), 2.1 Å

PDB Description: P. vulgaris HIGBA structure, crystal form 2
PDB Compounds: (C:) Antidote protein

SCOPe Domain Sequences for d4mcxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mcxc_ a.35.1.3 (C:) Antitoxin HigA {Proteus vulgaris [TaxId: 585]}
mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal
gstpefwlrlqsnydlrqlenqidtsgivlyg

SCOPe Domain Coordinates for d4mcxc_:

Click to download the PDB-style file with coordinates for d4mcxc_.
(The format of our PDB-style files is described here.)

Timeline for d4mcxc_: