![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
![]() | Protein Antitoxin HigA [158465] (2 species) Uncharacterized transcriptional regulator YddM |
![]() | Species Proteus vulgaris [TaxId:585] [229675] (3 PDB entries) |
![]() | Domain d4mcxc_: 4mcx C: [235601] automated match to d4mcxe_ |
PDB Entry: 4mcx (more details), 2.1 Å
SCOPe Domain Sequences for d4mcxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mcxc_ a.35.1.3 (C:) Antitoxin HigA {Proteus vulgaris [TaxId: 585]} mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal gstpefwlrlqsnydlrqlenqidtsgivlyg
Timeline for d4mcxc_: