Class a: All alpha proteins [46456] (286 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
Protein Antitoxin HigA [158465] (2 species) Uncharacterized transcriptional regulator YddM |
Species Proteus vulgaris [TaxId:585] [229675] (2 PDB entries) |
Domain d4mcxa_: 4mcx A: [229678] automated match to d2icta_ |
PDB Entry: 4mcx (more details), 2.1 Å
SCOPe Domain Sequences for d4mcxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mcxa_ a.35.1.3 (A:) Antitoxin HigA {Proteus vulgaris [TaxId: 585]} mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal gstpefwlrlqsnydlrqlenqidtsgivlyge
Timeline for d4mcxa_: