Lineage for d4mcvb_ (4mcv B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein c-src tyrosine kinase [56155] (2 species)
PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
Species Chicken (Gallus gallus) [TaxId:9031] [56157] (48 PDB entries) 
Domain d4mcvb_: 4mcv B: [229139]
automated match to d4lgha_
complexed with 29k
Details for d4mcvb_
PDB Entry: 4mcv (more details), 2.73 Å
PDB Description: star 12 bound to analog-sensitive src kinase
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase SrcSCOPe Domain Sequences for d4mcvb_:
Sequence, based on SEQRES records: (download)
>d4mcvb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly
grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc
qcwrkdpeerptfeylqafledyftstepqyqpgenl
Sequence, based on observed residues (ATOM records): (download)
>d4mcvb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkptmspeaflqeaqvmkkl
rheklvqlyavvseepiyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
ermnyvhrdlraanilvgenlvckvadfglarlikfpikwtapeaalygrftiksdvwsf
gilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerpt
feylqafledyftstepqyqpgenl
SCOPe Domain Coordinates for d4mcvb_:
Click to download the PDB-style file with coordinates for d4mcvb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mcvb_:
- d4mcvb_ first appeared in SCOPe 2.03
- d4mcvb_ appears in SCOPe 2.05
- d4mcvb_ appears in SCOPe 2.07
- d4mcvb_ appears in the current release, SCOPe 2.08
View in 3D
