Lineage for d4mcka1 (4mck A:1-198)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) Fold d.2: Lysozyme-like [53954] (1 superfamily)
common alpha+beta motif for the active site regionSuperfamily d.2.1: Lysozyme-like [53955] (12 families) 
Family d.2.1.0: automated matches [191411] (1 protein)
not a true familyProtein automated matches [190563] (18 species)
not a true protein
Species Maize (Zea mays) [TaxId:4577] [237294] (1 PDB entry) 
Domain d4mcka1: 4mck A:1-198 [237295]
Other proteins in same PDB: d4mcka2
automated match to d3hbex_
Details for d4mcka1
PDB Entry: 4mck (more details), 1.5 Å
PDB Description: Crystal structure of Family GH19, Class IV chitinase from Zea mays
PDB Compounds: (A:) chitinaseSCOPe Domain Sequences for d4mcka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mcka1 d.2.1.0 (A:1-198) automated matches {Maize (Zea mays) [TaxId: 4577]}
vvsdaffngiknqagsgcegknfytrsaflsavnaypgfahggtevegkreiaaffahvt
hqtghfcyiseinksnaycdasnrwpcaagqkyygrgplqiswnynygpagrdigfngla
dpnrvaqdaviafktalwfwmnnvhrlmpqgfgatirainglecngnnpaqmnarvgyyk
qycqqlrvdpgpnltc
SCOPe Domain Coordinates for d4mcka1:
Click to download the PDB-style file with coordinates for d4mcka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mcka1:
- d4mcka1 first appeared in SCOPe 2.03, called d4mcka_
- d4mcka1 appears in SCOPe 2.07
View in 3D
