Lineage for d4mcca_ (4mcc A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.116: alpha/beta knot [75216] (1 superfamily)
core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knotSuperfamily c.116.1: alpha/beta knot [75217] (9 families) 
known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
all known members have dimeric structures
Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomainProtein automated matches [196235] (4 species)
not a true proteinSpecies Haemophilus influenzae [TaxId:71421] [196236] (37 PDB entries) 
Domain d4mcca_: 4mcc A: [227801]
automated match to d1uaja_
complexed with 21x
Details for d4mcca_
PDB Entry: 4mcc (more details), 1.95 Å
PDB Description: hintrmd in complex with n-[4-(aminomethyl)benzyl]-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferaseSCOPe Domain Sequences for d4mcca_:
Sequence, based on SEQRES records: (download)
>d4mcca_ c.116.1.4 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlr
Sequence, based on observed residues (ATOM records): (download)
>d4mcca_ c.116.1.4 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlglldcphytrpevlegltvp
pvlmsghheeirkwrlkqslqrtwlr
SCOPe Domain Coordinates for d4mcca_:
Click to download the PDB-style file with coordinates for d4mcca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mcca_:
- d4mcca_ first appeared in SCOPe 2.03
- d4mcca_ appears in SCOPe 2.07
View in 3D
