Lineage for d4mbla_ (4mbl A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673733Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
    OPK group(?); PIM subfamily; serine/threonine kinase
  7. 1673734Species Human (Homo sapiens) [TaxId:9606] [118134] (65 PDB entries)
    Uniprot P11309 33-305 ! Uniprot P11309 32-308
  8. 1673803Domain d4mbla_: 4mbl A: [227911]
    automated match to d4k18a_
    complexed with 26l

Details for d4mbla_

PDB Entry: 4mbl (more details), 2.6 Å

PDB Description: Discovery of Pyrazolo[1,5a]pyrimidine-based Pim1 Inhibitors
PDB Compounds: (A:) Serine/threonine-protein kinase pim-1

SCOPe Domain Sequences for d4mbla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mbla_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs

SCOPe Domain Coordinates for d4mbla_:

Click to download the PDB-style file with coordinates for d4mbla_.
(The format of our PDB-style files is described here.)

Timeline for d4mbla_: