Lineage for d4mafc2 (4maf C:219-450)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.0: automated matches [191377] (1 protein)
not a true familyProtein automated matches [190459] (31 species)
not a true protein
Species Glycine max [TaxId:3847] [237649] (1 PDB entry) 
Domain d4mafc2: 4maf C:219-450 [237651]
Other proteins in same PDB: d4mafa1, d4mafc1
automated match to d1g8fa2
complexed with adx
Details for d4mafc2
PDB Entry: 4maf (more details), 2.48 Å
PDB Description: Soybean ATP Sulfurylase
PDB Compounds: (C:) ATP sulfurylaseSCOPe Domain Sequences for d4mafc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mafc2 c.26.1.0 (C:219-450) automated matches {Glycine max [TaxId: 3847]}
gldhfrlsptqlraeftrrnadavfafqlrnpvhnghallmtdtrkrllemgyknpvlll
hplggytkaddvpldwrmkqhekvledgvldpettvvsifpspmhyagptevqwhakari
naganfyivgrdpagmshpvekrdlydadhgkkvlsmapglerlnilpfrvaaydktqgk
maffdpsrpqdflfisgtkmrtlarnkesppdgfmcpggwkvlvdyydslvl
SCOPe Domain Coordinates for d4mafc2:
Click to download the PDB-style file with coordinates for d4mafc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mafc2:
- d4mafc2 is new in SCOPe 2.03-stable
- d4mafc2 appears in SCOPe 2.04
- d4mafc2 appears in the current release, SCOPe 2.08
View in 3D
