Lineage for d4maea_ (4mae A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. Family b.70.1.0: automated matches [227985] (1 protein)
    not a true family
  6. Protein automated matches [227986] (6 species)
    not a true protein
  7. Species Methylacidiphilum fumariolicum [TaxId:1156937] [227987] (2 PDB entries)
  8. Domain d4maea_: 4mae A: [227988]
    automated match to d2ad7a_
    complexed with 15p, ce, pqq

Details for d4maea_

PDB Entry: 4mae (more details), 1.6 Å

PDB Description: methanol dehydrogenase from methylacidiphilum fumariolicum solv
PDB Compounds: (A:) methanol dehydrogenase

SCOPe Domain Sequences for d4maea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4maea_ b.70.1.0 (A:) automated matches {Methylacidiphilum fumariolicum [TaxId: 1156937]}
ndeliklekepgqwvmqnknyantryselnqintknvsrlrlawsfstgalrgheggplv
vgttmyvhsaypnhvyaldltqkpyaikwqytpvqnsqavavaccdvvnrglayangkif
mttldgqiialdantgkelwkmkhadvtkgetitgaplvvkdkvlvgvsggefgvrgrvg
aydintgnrvwlaysqgpdeevlldsdfnkefpqhggpgdgtktwpgeqwklgggttwgw
ysydpaldlfyygtsnpgtwnaeqrkggdnkwsctifarrpdtgkarwayqmtpwdswdy
dgvnemilpdltvkgkktpclvhfdrngfgyvldrrtgqlieaqpfvyvnwakeiskend
rpveipekrtkqgvdtkgicpnsmggkdqqpaafspqtglfyvptnnmcmnyegveatyt
agapyvganvlmysghegkddyygaficydalkgkrvweihehfpvwsgpvvtagglafy
gtmdgwfkavdiktgkvlwqqklgsgiignpitflgpdkkqyvavysgvggwfgiavaqn
lppddpyaglgavgvayqaglpkattvggelyvfale

SCOPe Domain Coordinates for d4maea_ are not available.

Timeline for d4maea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4maeb_