Lineage for d4m8ua2 (4m8u A:483-561)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domain
Family b.71.1.0: automated matches [227134] (1 protein)
not a true familyProtein automated matches [226835] (41 species)
not a true protein
Species Bacillus subtilis [TaxId:224308] [228101] (5 PDB entries) 
Domain d4m8ua2: 4m8u A:483-561 [229320]
Other proteins in same PDB: d4m8ua1
automated match to d1uoka1
complexed with ca, gol, trs; mutant
Details for d4m8ua2
PDB Entry: 4m8u (more details), 1.45 Å
PDB Description: The Structure of MalL mutant enzyme V200A from Bacillus subtilus
PDB Compounds: (A:) Oligo-1,6-glucosidase 1SCOPe Domain Sequences for d4m8ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m8ua2 b.71.1.0 (A:483-561) automated matches {Bacillus subtilis [TaxId: 224308]}
gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypera
dlksislkpyeavmgisi
SCOPe Domain Coordinates for d4m8ua2:
Click to download the PDB-style file with coordinates for d4m8ua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4m8ua2:
- d4m8ua2 first appeared in SCOPe 2.03
- d4m8ua2 appears in SCOPe 2.07
View in 3D
