Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (31 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [228099] (5 PDB entries) |
Domain d4m8ua1: 4m8u A:2-482 [229319] Other proteins in same PDB: d4m8ua2 automated match to d1uoka2 complexed with ca, gol, trs; mutant |
PDB Entry: 4m8u (more details), 1.45 Å
SCOPe Domain Sequences for d4m8ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m8ua1 c.1.8.1 (A:2-482) automated matches {Bacillus subtilis [TaxId: 224308]} sewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddng ydisdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpy rdyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrev ydvmrfwmdrgvdgwrmdaigsiskytdfpdyetdhsrsyivgryhsngprlhefiqemn revlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikp fdlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgm kgtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdha rtpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimi y
Timeline for d4m8ua1: