Lineage for d4m8ua1 (4m8u A:2-482)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830357Species Bacillus subtilis [TaxId:224308] [228099] (5 PDB entries)
  8. 2830358Domain d4m8ua1: 4m8u A:2-482 [229319]
    Other proteins in same PDB: d4m8ua2
    automated match to d1uoka2
    complexed with ca, gol, trs; mutant

Details for d4m8ua1

PDB Entry: 4m8u (more details), 1.45 Å

PDB Description: The Structure of MalL mutant enzyme V200A from Bacillus subtilus
PDB Compounds: (A:) Oligo-1,6-glucosidase 1

SCOPe Domain Sequences for d4m8ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m8ua1 c.1.8.1 (A:2-482) automated matches {Bacillus subtilis [TaxId: 224308]}
sewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddng
ydisdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpy
rdyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrev
ydvmrfwmdrgvdgwrmdaigsiskytdfpdyetdhsrsyivgryhsngprlhefiqemn
revlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikp
fdlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgm
kgtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdha
rtpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimi
y

SCOPe Domain Coordinates for d4m8ua1:

Click to download the PDB-style file with coordinates for d4m8ua1.
(The format of our PDB-style files is described here.)

Timeline for d4m8ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m8ua2