Lineage for d4m8ia2 (4m8i A:209-321)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201804Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2201805Protein automated matches [226843] (8 species)
    not a true protein
  7. 2201844Species Staphylococcus epidermidis [TaxId:176279] [227789] (1 PDB entry)
  8. 2201845Domain d4m8ia2: 4m8i A:209-321 [227790]
    Other proteins in same PDB: d4m8ia1
    automated match to d4dxda2
    complexed with gdp, so4

Details for d4m8ia2

PDB Entry: 4m8i (more details), 1.43 Å

PDB Description: 1.43 angstrom resolution crystal structure of cell division protein ftsz (ftsz) from staphylococcus epidermidis rp62a in complex with gdp
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d4m8ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m8ia2 d.79.2.0 (A:209-321) automated matches {Staphylococcus epidermidis [TaxId: 176279]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfedkpss

SCOPe Domain Coordinates for d4m8ia2:

Click to download the PDB-style file with coordinates for d4m8ia2.
(The format of our PDB-style files is described here.)

Timeline for d4m8ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m8ia1