![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.0: automated matches [227141] (1 protein) not a true family |
![]() | Protein automated matches [226843] (8 species) not a true protein |
![]() | Species Staphylococcus epidermidis [TaxId:176279] [227789] (1 PDB entry) |
![]() | Domain d4m8ia2: 4m8i A:209-321 [227790] Other proteins in same PDB: d4m8ia1 automated match to d4dxda2 complexed with gdp, so4 |
PDB Entry: 4m8i (more details), 1.43 Å
SCOPe Domain Sequences for d4m8ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m8ia2 d.79.2.0 (A:209-321) automated matches {Staphylococcus epidermidis [TaxId: 176279]} ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfedkpss
Timeline for d4m8ia2: