Lineage for d4m85a_ (4m85 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921812Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1921813Protein automated matches [190038] (32 species)
    not a true protein
  7. 1921971Species Staphylococcus aureus [TaxId:158878] [259363] (2 PDB entries)
  8. 1921972Domain d4m85a_: 4m85 A: [259669]
    automated match to d1u6ma_

Details for d4m85a_

PDB Entry: 4m85 (more details), 2 Å

PDB Description: crystal structure of n-acetyltransferase from staphylococcus aureus mu50
PDB Compounds: (A:) n-acetyltransferase

SCOPe Domain Sequences for d4m85a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m85a_ d.108.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
snamirqarpedrfdiaklvymvwddmelelvkhlpkdmvldaiekscvdatyrtfyqhi
lvyevenkvagciisysgenelkyekawelldlpeeikqygtplpvkeakddeyyietia
tfaayrgrgiatklltsllesnthvkwslncdinneaalklykkvgfisdgqielykhmy
hhliv

SCOPe Domain Coordinates for d4m85a_:

Click to download the PDB-style file with coordinates for d4m85a_.
(The format of our PDB-style files is described here.)

Timeline for d4m85a_: