Lineage for d4m4rb_ (4m4r B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1775501Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins)
    eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF00812
  6. 1775517Protein automated matches [190316] (1 species)
    not a true protein
  7. 1775518Species Human (Homo sapiens) [TaxId:9606] [187131] (6 PDB entries)
  8. 1775523Domain d4m4rb_: 4m4r B: [253742]
    automated match to d1shxa_
    complexed with nag

Details for d4m4rb_

PDB Entry: 4m4r (more details), 3.13 Å

PDB Description: epha4 ectodomain complex with ephrin a5
PDB Compounds: (B:) Ephrin-A5

SCOPe Domain Sequences for d4m4rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m4rb_ b.6.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaavadryavywnssnprfqrgdyhidvcindyldvfcphyedsvpedkteryvlymvnf
dgysacdhtskgfkrwecnrphspngplkfsekfqlftpfslgfefrpgreyfyissaip
dngrrsclklkvfvrptnscm

SCOPe Domain Coordinates for d4m4rb_:

Click to download the PDB-style file with coordinates for d4m4rb_.
(The format of our PDB-style files is described here.)

Timeline for d4m4rb_: