Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Rhodococcus opacus [TaxId:37919] [257921] (1 PDB entry) |
Domain d4m0xa2: 4m0x A:130-371 [257922] Other proteins in same PDB: d4m0xa1, d4m0xb1 automated match to d1f9ca1 complexed with cl, mn |
PDB Entry: 4m0x (more details), 2.7 Å
SCOPe Domain Sequences for d4m0xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m0xa2 c.1.11.0 (A:130-371) automated matches {Rhodococcus opacus [TaxId: 37919]} lrrkripitwafsagsasdlideaaqkldvghrsfkfkmgaepadtdsrrvldvlecipd ecavivdpngrwseleahrwlpiladagvtvaeqpiarwntdglarlrdklsipimades vttvqqaialadagavsafaikipksgglsrareiaaiaeasglacfgaatpessvmgai saqlygtmpdlsvgcelfgpgllidevvteplkydrgelliptgpgsgvnldeerlrkys rd
Timeline for d4m0xa2: