Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (71 species) not a true protein |
Species Sphingomonas wittichii [TaxId:392499] [227977] (5 PDB entries) |
Domain d4lxga_: 4lxg A: [227979] automated match to d2og1a_ complexed with so4 |
PDB Entry: 4lxg (more details), 2.22 Å
SCOPe Domain Sequences for d4lxga_:
Sequence, based on SEQRES records: (download)
>d4lxga_ c.69.1.0 (A:) automated matches {Sphingomonas wittichii [TaxId: 392499]} mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignsmggttacgaalkape lidrlvlmgaavnispddmvanrddlaavmsydgseegmrkiiaalthsyqptddivhyr heaslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqil aipqaighvfpncghwvmieypeefctqtlhffgkl
>d4lxga_ c.69.1.0 (A:) automated matches {Sphingomonas wittichii [TaxId: 392499]} mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignsmggttacgaalkape lidrlvlmgaavnispddmvaddlaavmsydgseegmrkiiaalthsyqptddivhyrhe aslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqilai pqaighvfpncghwvmieypeefctqtlhffgkl
Timeline for d4lxga_: