![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins) automatically mapped to Pfam PF06560 |
![]() | Protein automated matches [196263] (1 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries) |
![]() | Domain d4lulb_: 4lul B: [257889] automated match to d1x82a_ complexed with mn; mutant |
PDB Entry: 4lul (more details), 1.89 Å
SCOPe Domain Sequences for d4lulb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lulb_ b.82.1.7 (B:) automated matches {Pyrococcus furiosus [TaxId: 186497]} mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi smepgtvvyvpadwahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk vvdnprwkk
Timeline for d4lulb_: