Lineage for d4lrwa_ (4lrw A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the restProtein automated matches [190047] (27 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries) 
Domain d4lrwa_: 4lrw A: [229315]
automated match to d4epxa_
complexed with gdp, mg
Details for d4lrwa_
PDB Entry: 4lrw (more details), 2.15 Å
PDB Description: crystal structure of k-ras g12c (cysteine-light), gdp-bound
PDB Compounds: (A:) GTPase KRasSCOPe Domain Sequences for d4lrwa_:
Sequence, based on SEQRES records: (download)
>d4lrwa_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtagq
eeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlp
srtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
Sequence, based on observed residues (ATOM records): (download)
>d4lrwa_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtaym
rtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdtkqaqd
larsygipfietsaktrqgvddafytlvreirkhk
SCOPe Domain Coordinates for d4lrwa_:
Click to download the PDB-style file with coordinates for d4lrwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lrwa_:
- d4lrwa_ first appeared in SCOPe 2.03
- d4lrwa_ appears in SCOPe 2.04
- d4lrwa_ appears in SCOPe 2.06
- d4lrwa_ appears in the current release, SCOPe 2.08
View in 3D
