Lineage for d4lo0a1 (4lo0 A:9-151)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791069Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1791277Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 1791278Protein automated matches [226913] (8 species)
    not a true protein
  7. 1791282Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries)
  8. 1791287Domain d4lo0a1: 4lo0 A:9-151 [253656]
    automated match to d2e4ma1

Details for d4lo0a1

PDB Entry: 4lo0 (more details), 2.06 Å

PDB Description: apo ha17-ha33
PDB Compounds: (A:) ha-33

SCOPe Domain Sequences for d4lo0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lo0a1 b.42.2.0 (A:9-151) automated matches {Clostridium botulinum [TaxId: 1491]}
nslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihn
tnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlk
lstlnnsnyikfiiedyiisdln

SCOPe Domain Coordinates for d4lo0a1:

Click to download the PDB-style file with coordinates for d4lo0a1.
(The format of our PDB-style files is described here.)

Timeline for d4lo0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lo0a2