![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (8 species) not a true protein |
![]() | Species Influenza a virus [TaxId:1332244] [228093] (9 PDB entries) |
![]() | Domain d4ln3e_: 4ln3 E: [228094] automated match to d1rvxa_ complexed with nag |
PDB Entry: 4ln3 (more details), 2.65 Å
SCOPe Domain Sequences for d4ln3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ln3e_ b.19.1.0 (E:) automated matches {Influenza a virus [TaxId: 1332244]} gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry vkqrslllatgmknvp
Timeline for d4ln3e_: