Lineage for d4llvf_ (4llv F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755462Domain d4llvf_: 4llv F: [228382]
    Other proteins in same PDB: d4llvb2, d4llvl2
    automated match to d2dtgd1
    complexed with gol, so4

Details for d4llvf_

PDB Entry: 4llv (more details), 2.39 Å

PDB Description: The structure of the unbound form of anti-HIV antibody 4E10 Fv
PDB Compounds: (F:) 4E10 Fv light chain

SCOPe Domain Sequences for d4llvf_:

Sequence, based on SEQRES records: (download)

>d4llvf_ b.1.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgvad
rfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkv

Sequence, based on observed residues (ATOM records): (download)

>d4llvf_ b.1.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgvad
rfsgsgtdftltisrlepedfavyycqqygqslstfgqgtkv

SCOPe Domain Coordinates for d4llvf_:

Click to download the PDB-style file with coordinates for d4llvf_.
(The format of our PDB-style files is described here.)

Timeline for d4llvf_: