| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries) |
| Domain d4llla_: 4lll A: [257032] automated match to d4l9na_ protein/DNA complex |
PDB Entry: 4lll (more details), 3.04 Å
SCOPe Domain Sequences for d4llla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4llla_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
eeneqmkanltkmlsslq
Timeline for d4llla_: