Lineage for d4lkia_ (4lki A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimers
Family b.19.1.0: automated matches [227246] (1 protein)
not a true familyProtein automated matches [227017] (34 species)
not a true protein
Species Influenza A virus [TaxId:11320] [228462] (22 PDB entries) 
Domain d4lkia_: 4lki A: [228795]
Other proteins in same PDB: d4lkib_
automated match to d1rvxa_
complexed with nag; mutant
Details for d4lkia_
PDB Entry: 4lki (more details), 2.7 Å
PDB Description: the structure of hemagglutinin l226q mutant from a avian-origin h7n9 influenza virus (a/anhui/1/2013)
PDB Compounds: (A:) HemagglutininSCOPe Domain Sequences for d4lkia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lkia_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg
ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt
ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvstaeq
tklygsgnklvtvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfngaf
iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq
rslllatgmknvpe
SCOPe Domain Coordinates for d4lkia_:
Click to download the PDB-style file with coordinates for d4lkia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lkia_:
- d4lkia_ first appeared in SCOPe 2.03
- d4lkia_ appears in SCOPe 2.05
- d4lkia_ appears in SCOPe 2.07
- d4lkia_ appears in the current release, SCOPe 2.08
View in 3D
