Lineage for d4lija_ (4lij A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648551Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1648552Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1648553Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 1648643Protein automated matches [195910] (2 species)
    not a true protein
  7. 1648646Species Human (Homo sapiens) [TaxId:9606] [195911] (4 PDB entries)
  8. 1648651Domain d4lija_: 4lij A: [229312]
    automated match to d1x4na1
    complexed with po4

Details for d4lija_

PDB Entry: 4lij (more details), 1.8 Å

PDB Description: crystal structure of a far upstream element (fuse) binding protein 1 (fubp1) from homo sapiens at 1.95 a resolution
PDB Compounds: (A:) Far upstream element-binding protein 1

SCOPe Domain Sequences for d4lija_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lija_ d.51.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsvmteeykvpdgmvgfiigrggeqisriqqesgckiqiapdsgglperscmltgtpesv
qsakrlldqivekgr

SCOPe Domain Coordinates for d4lija_:

Click to download the PDB-style file with coordinates for d4lija_.
(The format of our PDB-style files is described here.)

Timeline for d4lija_: