Lineage for d4lh7a_ (4lh7 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1433387Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (5 families) (S)
    has a circularly permuted topology
  5. 1433403Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins)
    automatically mapped to Pfam PF01653
  6. 1433404Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species)
    contains additional, N-terminal all-alpha subdomain
  7. 1433408Species Enterococcus faecalis [TaxId:1351] [118124] (8 PDB entries)
    Uniprot Q837V6 5-317
  8. 1433414Domain d4lh7a_: 4lh7 A: [230118]
    automated match to d1taea_
    complexed with 1x8, na, nmn

Details for d4lh7a_

PDB Entry: 4lh7 (more details), 1.9 Å

PDB Description: crystal structure of a liga inhibitor
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d4lh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lh7a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]}
eqqpltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlit
pdsptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelki
dglaislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkq
sfvalneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqf
ealeelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdel
gftvkaprwaiaykfppeeae

SCOPe Domain Coordinates for d4lh7a_:

Click to download the PDB-style file with coordinates for d4lh7a_.
(The format of our PDB-style files is described here.)

Timeline for d4lh7a_: