Lineage for d4lh4a_ (4lh4 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606866Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1606867Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 1606868Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (42 PDB entries)
  8. 1606912Domain d4lh4a_: 4lh4 A: [230119]
    automated match to d3vq9c_
    complexed with mg

Details for d4lh4a_

PDB Entry: 4lh4 (more details), 1.8 Å

PDB Description: dual inhibition of hiv-1 replication by integrase-ledgf allosteric inhibitors is predominant at post-integration stage during virus production rather than at integration
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4lh4a_:

Sequence, based on SEQRES records: (download)

>d4lh4a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records): (download)

>d4lh4a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqmnkelkkiigqvrdqaehlktavqmavfihnkkrkysag
erivdiiatdi

SCOPe Domain Coordinates for d4lh4a_:

Click to download the PDB-style file with coordinates for d4lh4a_.
(The format of our PDB-style files is described here.)

Timeline for d4lh4a_: