Lineage for d4lgha_ (4lgh A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein c-src tyrosine kinase [56155] (2 species)
PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
Species Chicken (Gallus gallus) [TaxId:9031] [56157] (48 PDB entries) 
Domain d4lgha_: 4lgh A: [224664]
automated match to d2z8ca1
complexed with 0jn
Details for d4lgha_
PDB Entry: 4lgh (more details), 2.84 Å
PDB Description: crystal structure of 1nm-pp1 bound to analog-sensitive src kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase SrcSCOPe Domain Sequences for d4lgha_:
Sequence, based on SEQRES records: (download)
>d4lgha_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly
grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc
qcwrkdpeerptfeylqafledyftstepqyqpgenl
Sequence, based on observed residues (ATOM records): (download)
>d4lgha_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
kdaweipreslrlevklgqggevwmgtwngtrvaiktleaqvmkklrheklvqlyavvse
epiyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraan
ilvgenlvckvadfpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnre
vldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpg
enl
SCOPe Domain Coordinates for d4lgha_:
Click to download the PDB-style file with coordinates for d4lgha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lgha_:
- d4lgha_ first appeared in SCOPe 2.03
- d4lgha_ appears in SCOPe 2.05
- d4lgha_ appears in SCOPe 2.07
- d4lgha_ appears in the current release, SCOPe 2.08
View in 3D
