Lineage for d4lfhg1 (4lfh G:10-125)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (31 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) 
Domain d4lfhg1: 4lfh G:10-125 [228079]
Other proteins in same PDB: d4lfhg2
automated match to d1hxmb1
complexed with act, na
Details for d4lfhg1
PDB Entry: 4lfh (more details), 2.3 Å
PDB Description: crystal structure of 9c2 tcr
PDB Compounds: (G:) 9C2 TCR gamma chainSCOPe Domain Sequences for d4lfhg1:
Sequence, based on SEQRES records: (download)
>d4lfhg1 b.1.1.0 (G:10-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtksvtrptrssaeitcdltvinafyihwylhqegkapqrllyydvsnskdvlesglspg
kyythtprrwswililrnliendsgvyycatwdrgnpkthyykklfgsgttlvvtd
Sequence, based on observed residues (ATOM records): (download)
>d4lfhg1 b.1.1.0 (G:10-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtksvtrptrssaeitcdltvinafyihwylhqegkapqrllyydvsnskdvlesglspg
kyythtprrwswililrnliendsgvyycatwdrykklfgsgttlvvtd
SCOPe Domain Coordinates for d4lfhg1:
Click to download the PDB-style file with coordinates for d4lfhg1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lfhg1:
- d4lfhg1 first appeared in SCOPe 2.03
- d4lfhg1 appears in SCOPe 2.07
View in 3D
