Lineage for d4lcza_ (4lcz A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028375Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)
  6. 3028388Protein automated matches [190507] (3 species)
    not a true protein
  7. 3028421Species Spinach (Spinacia oleracea) [TaxId:3562] [257007] (1 PDB entry)
  8. 3028422Domain d4lcza_: 4lcz A: [257008]
    automated match to d2bhwa_
    complexed with cac, chl, cla, lhg, lut, na, nex, zn

Details for d4lcza_

PDB Entry: 4lcz (more details), 2.6 Å

PDB Description: crystal structure of a multilayer-packed major light-harvesting complex
PDB Compounds: (A:) Major chlorophyll a/b binding protein LHCb1.3

SCOPe Domain Sequences for d4lcza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lcza_ f.43.1.1 (A:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
spwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfaknrelevihcrwam
lgalgcvfpellarngvkfgeavwfkagsqifseggldylgnpslvhaqsilaiwacqvi
lmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvkeikngrlamfsmfg
ffvqaivtgkgplenladhladpvnnna

SCOPe Domain Coordinates for d4lcza_:

Click to download the PDB-style file with coordinates for d4lcza_.
(The format of our PDB-style files is described here.)

Timeline for d4lcza_: