![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins) |
![]() | Protein automated matches [190507] (3 species) not a true protein |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [257007] (1 PDB entry) |
![]() | Domain d4lcza_: 4lcz A: [257008] automated match to d2bhwa_ complexed with cac, chl, cla, lhg, lut, na, nex, zn |
PDB Entry: 4lcz (more details), 2.6 Å
SCOPe Domain Sequences for d4lcza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lcza_ f.43.1.1 (A:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} spwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfaknrelevihcrwam lgalgcvfpellarngvkfgeavwfkagsqifseggldylgnpslvhaqsilaiwacqvi lmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvkeikngrlamfsmfg ffvqaivtgkgplenladhladpvnnna
Timeline for d4lcza_: