Lineage for d4lbla_ (4lbl A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1780718Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 1780837Protein Galectin-3 CRD [49940] (1 species)
  7. 1780838Species Human (Homo sapiens) [TaxId:9606] [49941] (30 PDB entries)
  8. 1780857Domain d4lbla_: 4lbl A: [236177]
    automated match to d1a3ka_
    complexed with cl; mutant

Details for d4lbla_

PDB Entry: 4lbl (more details), 1.58 Å

PDB Description: crystal structure of human galectin-3 crd k176l mutant in complex with a-gm3
PDB Compounds: (A:) Galectin-3

SCOPe Domain Sequences for d4lbla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lbla_ b.29.1.3 (A:) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]}
mlivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
cntlldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
klgisgdidltsasytmi

SCOPe Domain Coordinates for d4lbla_:

Click to download the PDB-style file with coordinates for d4lbla_.
(The format of our PDB-style files is described here.)

Timeline for d4lbla_: