Lineage for d4l8ea2 (4l8e A:92-209)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domainFamily a.45.1.0: automated matches [227130] (1 protein)
not a true familyProtein automated matches [226831] (73 species)
not a true protein
Species Xenorhabdus nematophila [TaxId:406817] [226706] (1 PDB entry) 
Domain d4l8ea2: 4l8e A:92-209 [224596]
Other proteins in same PDB: d4l8ea1
automated match to d1k0db1
complexed with cl, gsh, mes
Details for d4l8ea2
PDB Entry: 4l8e (more details), 1.7 Å
PDB Description: Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
PDB Compounds: (A:) Glutathione S-transferase enzyme with thioredoxin-like domainSCOPe Domain Sequences for d4l8ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l8ea2 a.45.1.0 (A:92-209) automated matches {Xenorhabdus nematophila [TaxId: 406817]}
lskdtrerteqlqwlfwqvagfgpmlgqnhhfnryapevvpyaikryteesqrlykvlnt
qlektpylggneysiadiavypwakcyehqkinledypavkkwlekiqqrpatqaayn
SCOPe Domain Coordinates for d4l8ea2:
Click to download the PDB-style file with coordinates for d4l8ea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4l8ea2:
- d4l8ea2 first appeared in SCOPe 2.03
- d4l8ea2 appears in SCOPe 2.07
View in 3D
