SCOPe 2.06: Domain d4l4vd2: 4l4v D:111-200

Lineage for d4l4vd2 (4l4v D:111-200)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

Domain d4l4vd2: 4l4v D:111-200 [227541]
Other proteins in same PDB: d4l4va1, d4l4va2, d4l4vb_, d4l4vc1, d4l4vc2, d4l4vc3, d4l4vd1, d4l4ve1, d4l4ve2, d4l4vf_, d4l4vg1, d4l4vh1, d4l4vh2
automated match to d2f54d2
complexed with 1vy, gol

Details for d4l4vd2

PDB Entry: 4l4v (more details), 1.9 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-RL-6-Me-7-OH

PDB Compounds: (D:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d4l4vd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4vd2 b.1.1.2 (D:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d4l4vd2:

Click to download the PDB-style file with coordinates for d4l4vd2.
(The format of our PDB-style files is described here.)

Timeline for d4l4vd2: