SCOPe 2.03: Domain d4l4vd1: 4l4v D:1-110

Lineage for d4l4vd1 (4l4v D:1-110)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (23 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
Domain d4l4vd1: 4l4v D:1-110 [227523]
Other proteins in same PDB: d4l4vd2, d4l4vg2
automated match to d2f54d1
complexed with 1vy, gol

Details for d4l4vd1

PDB Entry: 4l4v (more details), 1.9 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-RL-6-Me-7-OH

PDB Compounds: (D:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d4l4vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4vd1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d4l4vd1:

Click to download the PDB-style file with coordinates for d4l4vd1.
(The format of our PDB-style files is described here.)

Timeline for d4l4vd1: