SCOPe 2.04: Domain d4l4ta1: 4l4t A:0-178

Lineage for d4l4ta1 (4l4t A:0-178)

Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.0: automated matches [227140] (1 protein)
not a true family
Protein automated matches [226842] (4 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries)

Domain d4l4ta1: 4l4t A:0-178 [235264]
Other proteins in same PDB: d4l4ta2, d4l4tb_, d4l4tc2, d4l4td1, d4l4td2, d4l4te1, d4l4te2, d4l4tf_, d4l4tg1, d4l4tg2, d4l4th1, d4l4th2
automated match to d1agda2
complexed with 6fp

Details for d4l4ta1

PDB Entry: 4l4t (more details), 2 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-6-FP

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4l4ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4ta1 d.19.1.0 (A:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhw
erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf
lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4l4ta1:

Click to download the PDB-style file with coordinates for d4l4ta1.
(The format of our PDB-style files is described here.)

Timeline for d4l4ta1: