| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
| Protein automated matches [226842] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries) |
| Domain d4l4ta1: 4l4t A:0-178 [235264] Other proteins in same PDB: d4l4ta2, d4l4tb_, d4l4tc2, d4l4td1, d4l4td2, d4l4te1, d4l4te2, d4l4tf_, d4l4tg1, d4l4tg2, d4l4th1, d4l4th2 automated match to d1agda2 complexed with 6fp |
PDB Entry: 4l4t (more details), 2 Å
SCOPe Domain Sequences for d4l4ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l4ta1 d.19.1.0 (A:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhw
erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf
lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4l4ta1: